Recombinant humaan VIP36/LMAN2/GP36b (C-6His)
Gecertificeerd

Recombinant humaan VIP36/LMAN2/GP36b (C-6His)

Catalog #: 32-7675-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :32.7kD. Recombinant Human Vesicular Integral-Membrane Protein VIP36 is produced by our Mammalian expression system and the target gene encoding Asp45-Arg322 is expressed with a 6His tag at the C-terminus. Vesicular integral-membrane protein VIP36 is also known as Glycoprotein GP36b, Lectin mannose-binding 2, Vesicular integral-membrane protein 36, LMAN2 and C5orf8. LMAN2 is widely expressed and contains one L-type lectin-like domain. LMAN2 binds high mannose type glycoproteins and may facilitate their sorting, trafficking and quality control. LMAN2 plays a role as an intracellular lectin in the early secretory pathway. LMAN2 interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. LMAN2 is also involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.

Gene Name

LMAN2

Gene ID

10960

UniProt

Q12907

Components

Lyophilized from a 0.2 μm filtered solution of 50mM TrisHCl,10mM GSH, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVDHHHHHH

Beschrijving

Source: Human Cells. MW :32.7kD. Recombinant Human Vesicular Integral-Membrane Protein VIP36 is produced by our Mammalian expression system and the target gene

Specificaties

ProductnaamRecombinant humaan VIP36/LMAN2/GP36b (C-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-7675-10