Recombinant humaan Vitronectine/VTN (C-6His)
Gecertificeerd

Recombinant humaan Vitronectine/VTN (C-6His)

Catalog #: 32-7360-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :53.35kD. Recombinant Human Vitronectin is produced by our Mammalian expression system and the target gene encoding Asp20-Leu478 is expressed with a 6His tag at the C-terminus. Human Vitronectin/VTN is a cell adhesion and spreading factor. It can be found in the blood and the extracellular matrix (ECM) . Vitronectin interacts with glycosaminoglycans and proteoglycans. The multimeric Vitronectin can efficiently bind to and incorporate into the ECM; Vitronectin can support cell adhesion through binding to various integrins and other proteoglycans. Vitronectin can be recognized by certain members of the integrin family and serves as a cell-to-substrate adhesion molecular. It can as a inhibitor of the membrane-damaging effect of the terminal cytolytic complement pathway. Vitronectin contains an endogenous cleavage site, plus cleavage sites for elastase, thrombin, and plasmin.

Gene Name

VTN

Gene ID

7448

UniProt

P04004

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRAMWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHLVDHHHHHH

Beschrijving

Source: Human Cells. MW :53.35kD. Recombinant Human Vitronectin is produced by our Mammalian expression system and the target gene encoding Asp20-Leu478 is expr

Specificaties

ProductnaamRecombinant humaan Vitronectine/VTN (C-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-7360-10