Recombinant humaan weefselremmer van metalloproteïnaseremmers 1/TIMP-1 (C-6His)
Gecertificeerd

Recombinant humaan weefselremmer van metalloproteïnaseremmers 1/TIMP-1 (C-6His)

Catalog #: 32-7410-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :21.75kD. Recombinant Human Tissue Inhibitor of Metalloproteinases 1 is produced by our Mammalian expression system and the target gene encoding Cys24-Ala207 is expressed with a 6His tag at the C-terminus. Tissue Inhibitor of Metalloproteinases 1 (TIMP-1) complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Also mediates erythropoiesis in vitro; but, unlike IL-3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-11, MMP-12, MMP-13, and MMP-16. TIMP-1 does not act on MMP-14.

Gene Name

TIMP1

Gene ID

7076

UniProt

P01033

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIAVDHHHHHH

Beschrijving

Source: Human Cells. MW :21.75kD. Recombinant Human Tissue Inhibitor of Metalloproteinases 1 is produced by our Mammalian expression system and the target gene

Specificaties

ProductnaamRecombinant humaan weefselremmer van metalloproteïnaseremmers 1/TIMP-1 (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-7410-50