Recombinant Humaan zinkvindereiwit 75A/ZNF75A (N-6His)

Source: E.coli. MW :14.33kD. Recombinant Human Zinc Finger Protein 75A is produced by our E.coli expression system and the target gene encoding Ser58-Lys162 is expressed with a 6His tag at the N-terminus. Zinc Finger Protein 75A (ZNF75A) is a member of krueppel C2H2-type zinc-finger protein family. The human ZNF75 gene is located on Xq26, which has only limited homology (less than 65%) to other ZF genes in the databases. One of these, ZNF75B is a pseudogene mapped to chromosome 12q13. The other two, ZNF75A and ZNF75C, maintain an ORF in the sequenced region, and at least the latter is expressed in the U937 cell line. ZNF75A contains five C2H2-type zinc fingers and one KRAB domain. ZNF75A is a nucleus protein, may involves in transcriptional regulation.

ZNF75A

7627

Q96N20

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MGSSHHHHHHSSGLVPRGSHMSPEFKDSAGKSPTGLKLKNDTENHQPVSLSDLEIQASAGVISKKAKVKVPQKTAGKENHFDMHRVGKWHQDFPVKKRKKLSTWKQELLKLMDRHKKDCAREKPFK