Recombinant Human Alpha 1-Microglobuline/AMBP (C-6His)

Source: Human Cells. MW :21.9kD. Recombinant Human alpha 1-Microglobulin is produced by our Mammalian expression system and the target gene encoding Gly20-Val203 is expressed with a 6His tag at the C-terminus. Protein AMBP belongs to the calycin superfamily and Lipocalin family. AMBP can be cleaved into three chains: a-1-microglobulin, inter-a-trypsin inhibitor light chain and trypstatin. AMBP is expressed by the liver and secreted in plasma. a-1-microglobulin occurs in many physiological fluids including the plasma, urine, and cerebrospinal fluid. Inter-a-trypsin inhibitor is present in the plasma and urine. a-1-microglobulin occurs as a monomer and also in complexes with IgA and albumin, Inter-a-trypsin inhibitor inhibits trypsin, plasmin and lysosomal granulocytic elastase. Trypstatin act as a trypsin inhibitor, exists in a monomer forms and also occurs as a complex with tryptase in mast cells.

AMBP

259

P02760

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVVDHHHHHH