Recombinant Human CD99 Antigen-Like Protein 2/CD99L2 (C-6His)
Gecertificeerd

Recombinant Human CD99 Antigen-Like Protein 2/CD99L2 (C-6His)

Catalog #: 32-7790-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :18.4kD. Recombinant Human CD99 Antigen-Like Protein 2 is produced by our Mammalian expression system and the target gene encoding Asp26-Ala188 is expressed with a 6His tag at the C-terminus. CD99 Antigen-Like Protein 2 (CD99L2) belongs to the CD99 family. CD99L2 is a single-pass type I membrane protein and expressed in many tissues, with low expression in thymus. CD99L2 plays a role in a late step of leukocyte extravasation helping cells to overcome the endothelial basement membrane. CD99L2 and CD99 are involved in trans-endothelial migration of neutrophils in vitro and in the recruitment of neutrophils into inflamed peritoneum. A similar protein in mouse functions as an adhesion molecule during leukocyte extravasation. Alternate splicing results in multiple transcript variants.

Gene Name

CD99L2

Gene ID

83692

UniProt

Q8TCZ2

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIAVDHHHHHH

Beschrijving

Source: Human Cells. MW :18.4kD. Recombinant Human CD99 Antigen-Like Protein 2 is produced by our Mammalian expression system and the target gene encoding Asp26

Specificaties

ProductnaamRecombinant Human CD99 Antigen-Like Protein 2/CD99L2 (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-7790-50