Recombinant Human CLEC10A/CD301 (C-6His)

Source: Human Cells. MW :29.8kD. Recombinant Human CLEC10A is produced by our Mammalian expression system and the target gene encoding Gln61-His316 is expressed with a 6His tag at the C-terminus. C-Type Lectin Domain Family 10 Member A (CLEC10A) is a type II transmembrane C-type lectin that is expressed on immature myleloid dendritic cells and alternatively activated (tolerogenic) macrophages. CLEC10A/MGL binds and internalizes molecules with terminal nonsialylated GalNAc carbohydrates such as the Tn carcinoma antigen. CLEC10A/MGL also binds the GP envelope glycoprotein on Marburg and Ebola viruses and enhances viral entry and infectivity. It constitute a unique class of C-type lectins because of their specificity for galactose and its structural homologues. CLEC10A is thought to participate in the recognition of molecules from both altered self and pathogens due to its monosaccharide specificity for Gal and N-acetylgalactosamine (GalNAc) . Human and rat carry a single gene for CLEC10A/MGL, while mouse has two closely related MGL1 and MGL2 genes.

CLEC10A

10462

Q8IUN9

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESHVDHHHHHH