Recombinant Human Cystatine SN/CST1 (C-6His)

Source: Human Cells. MW :15.35kD. Recombinant Human Cystatin SN is produced by our Mammalian expression system and the target gene encoding Trp21-Ser141 is expressed with a 6His tag at the C-terminus. Cystatin-SN is a member of family 2 of the Cystatin superfamily and a cysteine proteinase inhibitor found in saliva, tears, urine, and seminal fluid. Together with Cystatins S and SA, it is produced by the salivary gland and secreted largely in the submandibular/sublingual saliva. Cystatin-SN inhibits members of the Papain family including Cathepsins B, C, H and L.

CST1

1469

P01037

Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

WSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQESVDHHHHHH