Recombinant Human DnaJ Homolog Subfamilie B Lid 1/DNAJB1 (C-6His)

Source: E. coli. MW :39.1kD. Recombinant Human Heat Shock 40 kDa Protein is produced by our E.coli expression system and the target gene encoding Gly2-Ile340 is expressed with a 6His tag at the C-terminus. DnaJ Homolog Subfamily B Member 1 (DNAJB1) is a member of the heat shock protein family. Heat shock proteins (HSPs) are a highly conserved family of stress response proteins. HSPs function primarily as molecular chaperones, facilitating the folding of other cellular proteins, preventing protein aggregation, or targeting improperly folded proteins to specific degradative pathways. DNAJB1 regulates cellular processes by aiding in the folding, transport and assembly. DNAJB1 contains a J-domain which controls interaction with the ATPase domain of DnaK. DNAJB1 interacts with HSP70 and can stimulate its ATPase activity. In addition, DNAJB1 stimulates the association between HSC70 and HIP.

DNAJB1

3337

P25685

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,1mM EDTA, pH7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

GKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPILEHHHHHH