Recombinant Human Early Placenta Insuline-Like Peptide/INSL4/Placentin (C-6His)

Source: Human Cells. MW :13.6kD. Recombinant Human Placentin is produced by our Mammalian expression system and the target gene encoding Ala26-Thr139 is expressed with a 6His tag at the C-terminus. Early Placenta Insulin-Like Peptide (INSL4) belongs to the insulin family. INSL4 is expressed in the early placental cytotrophoblast and syncytiotrophoblast INSL4 is a secreted protein and a precursor that undergoes post-translational cleavage to produce 3 polypeptide chains, A-C, that form tertiary structures composed of either all three chains, or just the A and B chains. INSL4 plays an important role in the development of trophoblast and in the regulation of bone formation.

INSL4

3641

Q14641

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl, pH 8.0.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCTVDHHHHHH