Recombinant Human Eukaryotic Translation Initiative Factor 1B/EIF1B (N-6His)
Gecertificeerd

Recombinant Human Eukaryotic Translation Initiative Factor 1B/EIF1B (N-6His)

Catalog #: 32-7198-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E.coli. MW :15kD. Recombinant Human EIF1B is produced by our E.coli expression system and the target gene encoding Met1-Phe113 is expressed with a 6His tag at the N-terminus. Eukaryotic Translation Initiation Factor 1B (EIF1B) is an element of a complex involved in recognition of the initiator codon during the scanning process. Translation is also initiated by the function of EIF1B in regulating the activity of ribosomal subunits 43S, 48S and 40S. EIF1B enables 43S ribosomal complexes to distinguish between cognate and near-cognate initiation codons, perceiving the nucleotide content of initiation codons.

Gene Name

EIF1B

Gene ID

10289

UniProt

O60739

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 500mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF

Beschrijving

Source: E.coli. MW :15kD. Recombinant Human EIF1B is produced by our E.coli expression system and the target gene encoding Met1-Phe113 is expressed with a 6His

Specificaties

ProductnaamRecombinant Human Eukaryotic Translation Initiative Factor 1B/EIF1B (N-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-7198-50