Recombinant Human Fibroblast Growth Factor 1/FGF-1/FGFa (Ala2-Asp155)
Gecertificeerd

Recombinant Human Fibroblast Growth Factor 1/FGF-1/FGFa (Ala2-Asp155)

Catalog #: 32-8338-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E. coli. MW :31.6kD. Recombinant Human Fibroblast growth factor 1 is produced by our E.coli expression system and the target gene encoding Ala2-Asp155 is expressed. FGF acidic, also known as ECGF, FGF-1and HBGF-1, is a non-glycosylated heparin binding growth factor that is expressed in the brain, kidney, retina, smooth muscle cells, bone matrix, osteoblasts, astrocytes and endothelial cells. It is a mitogenic peptide that is produced by multiple cell types and stimulates the proliferation of cells of mesodermal, ectodermal, and endodermal origin. Its association with heparan sulfate is a prerequisite for activation of FGF receptors. Internalized FGF acidic migrates to the nucleus where it is phosphorylated by nuclear PKC delta, exported to the cytosol, dephosphorylated, and degraded. Intracellular FGF acidic inhibits p53 activity and proapoptotic signaling.

Gene Name

FGF1

Gene ID

2246

UniProt

P05230

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Beschrijving

Source: E. coli. MW :31.6kD. Recombinant Human Fibroblast growth factor 1 is produced by our E.coli expression system and the target gene encoding Ala2-Asp155 i

Specificaties

ProductnaamRecombinant Human Fibroblast Growth Factor 1/FGF-1/FGFa (Ala2-Asp155)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-8338-10