Recombinant Human Fibroblast Growth Factor 2/FGF-2/FGFb (Gly132-Ser288)
Gecertificeerd

Recombinant Human Fibroblast Growth Factor 2/FGF-2/FGFb (Gly132-Ser288)

Catalog #: 32-7039-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E. coli. MW :16.4kD. Recombinant Human Fibroblast growth factor 2 is produced by our E.coli expression system and the target gene encoding Gly132-Ser288 is expressed. FGF-basic is a members of the Fibroblast Growth Factors (FGFs) family.The family constitutes a large family of proteins involved in many aspects of development including cell proliferation, growth, and differentiation. They act on several cell types to regulate diverse physiologic functions including angiogenesis, cell growth, pattern formation, embryonic development, metabolic regulation, cell migration, neurotrophic effects, and tissue repair. FGF-basic is a non-glycosylated heparin binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland liver, monocytes, epithelial cells and endothelial cells. FGF-basic signals through FGFR 1b, 1c, 2c, 3c and 4.

Gene Name

FGF2

Gene ID

2247

UniProt

P09038

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : The ED50 for this effect is less than 0.6 ng/mL, measured in a cell proliferation assay using BALB/c 3T3 cells.

Amino Acids

GTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Beschrijving

Source: E. coli. MW :16.4kD. Recombinant Human Fibroblast growth factor 2 is produced by our E.coli expression system and the target gene encoding Gly132-Ser288

Specificaties

ProductnaamRecombinant Human Fibroblast Growth Factor 2/FGF-2/FGFb (Gly132-Ser288)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-7039-10