
Recombinant Human Fibroblast Growth Factor Receptor 3/FGFR3 (C-6His)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Source: Human Cells. MW :39kD. Recombinant Human Fibroblast Growth Factor Receptor 3 is produced by our Mammalian expression system and the target gene encoding Glu23-Gly375 is expressed with a 6His tag at the C-terminus. Fibroblast growth factors (FGFs) comprise a family of at least eighteen structurally related proteins that are involved in a multitude of physiological and pathological cellular processes, including cell growth, differentiation, angiogenesis, wound healing and tumorgenesis. The biological activities of the FGFs are mediated by a family of type I transmembrane tyrosine kinases which undergo dimerization and autophosphorylation after ligand binding. Four distinct genes encoding closely related FGF receptors, FGF R1-4, are known. All four genes for FGF Rs encode proteins with an N-terminal signal peptide, three immunoglobulin (Ig) -like domains, an acid-box region containing a run of acidic residues between the IgI and IgII domains, a transmembrane domain and the split tyrosine-kinase domain. Multiple forms of FGF R1-3 are generated by alternative splicing of the mRNAs. A frequent splicing event involving FGF R1 and 2 results in receptors containing all three Ig domains, referred to as the a isoform, or only IgII and IgIII, referred to as the beta isoform. Only the a isoform has been identified for FGF R3 and FGF R4. Additional splicing events for FGF R1-3, involving the C-terminal half of the IgIII domain encoded by two mutually exclusive alternative exons, generate FGF receptors with alternative IgIII domains (IIIb and IIIc) . The complex patterns of expression of these receptors as well as the specificity of their interactions with the various FGF ligand family members are under investigation.
FGFR3
2261
P22607
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
The product is shipped at ambient temperature.
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAGHHHHHH
Beschrijving
Source: Human Cells. MW :39kD. Recombinant Human Fibroblast Growth Factor Receptor 3 is produced by our Mammalian expression system and the target gene encoding
Specificaties
Recent bekeken producten

Recombinant TAFV GP1 Protein, C-Fc
EVV03609
100 μg

Gabbr1 Mouse Monoclonal Antibody [Clone ID: S93A-49]
TA326530
100 µg

BSA-Myc/DDK Control Protein
AR100025
50 µL

NH-6
ABC-TC0826
1 Vial

Anti-TAT (Thrombin-antithrombin) Antibody
ABS 014-22-1
1000 µL

Anti-APOE2 mouse monoclonal antibody
TD-AB0132
100 µg

CD35 (CR1) mouse monoclonal antibody, clone J3D3, Azide Free
BM2364
0.2 mg

Anti-KIR2DL1 (Rabbit, Monoclonal, Rabbit mAb)
A115392
100 µL
Recent gezochte producten

Neprilysin Activity Assay Kit (Fluorometric)
K487-100
100 Assays

Caspase 10 Fluorometric Assay Kit
55R-1284
25 assays

Caspase Fluorometric Substrate Set Plus
55R-1316
7 x 25 assays

Caspase 5 Fluorometric Assay Kit
55R-1282
25 assays

Fluorometric Xanthine Oxidase Assay Kit
K2278-500
500 Assays

Fluorometric Proteasome 20S Activity Assay Kit
K2242-100
100 Tests

Creatinine Colorimetric/Fluorometric Assay Kit
K2130-100
100 Assays

Caspase-2 Inhibitor Drug Screening Kit (Fluorometric)
K2158-100
100 Assays
