Recombinant Human High Mobility Group Proteïne B1/HMGB1
Gecertificeerd

Recombinant Human High Mobility Group Proteïne B1/HMGB1

Catalog #: 32-8089-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E. coli. MW :10.5kD. Recombinant Human High Mobility Group Protein B1 is produced by our E.coli expression system and the target gene encoding Gly2-Phe89 is expressed. High mobility group protein B1 is a member of the HMGB family consisting of three members, HMGB1, HMGB2 and HMGB3.It Contains 2 HMG box DNA-binding domains entitled box A and box B and It is a highly negative-charged C terminus. As a nuclear protein, HMGB1 stabilizes nucleosomes and allows bending of DNA that facilitates gene transcription which is essential for individual survival. Meanwhile, it is revealed that HMGB1 can also act as a cytokine extracellularlly and regulates monocyte, T cell, dendritic cell activities in inflammatory responses.

Gene Name

HMGB1

Gene ID

3146

UniProt

P09429

Components

Lyophilized from a 0.2 μm filtered solution of 50mMHepes,500mMNaCl,0.5mMDTT, pH7.9 .

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKF

Beschrijving

Source: E. coli. MW :10.5kD. Recombinant Human High Mobility Group Protein B1 is produced by our E.coli expression system and the target gene encoding Gly2-Phe8

Specificaties

ProductnaamRecombinant Human High Mobility Group Proteïne B1/HMGB1
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-8089-10