Recombinant Human High Mobility Group Proteïne B1/HMGB1 (N-MARI)

Source: E. coli. MW :10kD. Recombinant Human High mobility group protein B1 is produced by our E.coli expression system and the target gene encoding Pro92-Val176 is expressed with a MARI tag at the N-terminus. High mobility group protein B1 is a member of the HMGB family consisting of three members, HMGB1, HMGB2 and HMGB3.It Contains 2 HMG box DNA-binding domains entitled box A and box B and It is a highly negative-charged C terminus. As a nuclear protein, HMGB1 stabilizes nucleosomes and allows bending of DNA that facilitates gene transcription which is essential for individual survival. Meanwhile, it is revealed that HMGB1 can also act as a cytokine extracellularlly and regulates monocyte, T cell, dendritic cell activities in inflammatory responses.

HMGB1

3146

P09429

Lyophilized from a 0.2 μm filtered solution of 50mM HEPES-Na, p H 7.9,500mM NaCl,0.6mM DTT.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MARIDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVV