Recombinant Human IA2/PTPRN (Gln607-Asn686 & Trp795-Leu888, N-6His)
Gecertificeerd

Recombinant Human IA2/PTPRN (Gln607-Asn686 & Trp795-Leu888, N-6His)

Catalog #: 32-8366-10
Maat: 10 µg
Droogijs Vereist

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E. coli. MW :22.9kD. Recombinant Human PTPRN is produced by our E.coli expression system and the target gene encoding Gln607-Asn686&Trp795-Leu888 is expressed with a 6His tag at the N-terminus. Receptor-type tyrosine-protein phosphatase-like N (PTPRN) belongs to the protein-tyrosine phosphatase family and receptor class 8 subfamily. PTPRN contains 1 tyrosine-protein phosphatase domain, is expressed in neuroendocrine cells only. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. It implicated in neuroendocrine secretory processes. It may be involved in processes specific for neurosecretory granules, such as their biogenesis, trafficking or regulated exocytosis or may have a general role in neuroendocrine functions. It seems to lack intrinsic enzyme activity, may play a role in the regulation of secretory granules via its interaction with SNTB2. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus.

Gene Name

PTPRN

Gene ID

5798

UniProt

Q16849

Components

Supplied as a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANGGGGSGGGGSGGGGSWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLL

Beschrijving

Source: E. coli. MW :22.9kD. Recombinant Human PTPRN is produced by our E.coli expression system and the target gene encoding Gln607-Asn686&Trp795-Leu888 is exp

Specificaties

ProductnaamRecombinant Human IA2/PTPRN (Gln607-Asn686 & Trp795-Leu888, N-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-8366-10