Recombinant Human IL-2 Receptor Subunit gamma/IL-2RG/CD132 (C-Fc)

Source: Human Cells. MW :55.4kD. Recombinant Human Cytokine receptor common subunit gamma is produced by our Mammalian expression system and the target gene encoding Leu23-Ala262 is expressed with a Fc tag at the C-terminus. IL2RG contains one fibronectin type-III domain. IL2RG is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. IL2RG interacts with SHB upon interleukin stimulation and HTLV-1 accessory protein p12I. Defects in IL2RG are the cause of X-linked combined immunodeficiency (XCID) and severe combined immunodeficiency X-linked T-cell-negative /B-cell-positive / NK-cell-negative (XSCID) .

IL2RG

3561

P31785

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK