Recombinant Human Interleukin-17A/F Heterodimer/IL-17A & IL-17F (C-6His)
Gecertificeerd

Recombinant Human Interleukin-17A/F Heterodimer/IL-17A & IL-17F (C-6His)

Catalog #: 32-8440-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: HEK293. MW :43.2kD. Recombinant Human IL-17A &IL-17F Heterodimer is produced by our Mammalian expression system and the target gene encoding Ile20-Ala155&Arg31-Gln163 is expressed with a 6His tag at the C-terminus. The IL-17 family include IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F. The family is comprised of at least six proinflammatory cytokines that share a conserved cysteine-knot structure but diverge at the N-terminus. All members of the IL-17 family have a similar protein structure, with four highly conserved cysteine residues critical to their 3-dimensional shape, yet they have no sequence similarity to any other known cytokines. IL-17 family members are glycoproteins secreted as dimers that induce local cytokine production and recruit granulocytes to sites of inflammation. IL-17 is induced by IL-15 and IL-23, mainly in activated CD4+ T cells distinct from Th1 or Th2 cells. IL-17F is the most homologous to IL-17, but is induced only by IL-23 in activated monocytes.

Gene Name

IL17A

Gene ID

3605

UniProt

Q16552

Components

Protein in sterile PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% tween-80.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Protein should be stored at -20°C, though stable at room temperature for 3 weeks. Dilute in PBS.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MTSTLPFSPQVSTPRSKFKRISSEFAATMTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAMTSTLPFSPQVSTPRSKFKRISSVLSIEFAATMTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQVDHHHHHH

Beschrijving

Source: HEK293. MW :43.2kD. Recombinant Human IL-17A &IL-17F Heterodimer is produced by our Mammalian expression system and the target gene encoding Ile20-Ala15

Specificaties

ProductnaamRecombinant Human Interleukin-17A/F Heterodimer/IL-17A & IL-17F (C-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-8440-10