Recombinant Human Interleukin-17F/IL-17F
Gecertificeerd

Recombinant Human Interleukin-17F/IL-17F

Catalog #: 32-7024-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E.coli. MW :30.1kD. Recombinant Human Interleukin-17F is produced by our E.coli expression system and the target gene encoding Arg31-Gln163 is expressed. Interleukin-17 is a potent pro-inflammatory cytokine produced by activated memory T cells. There are at least six members of the IL-17 family in humans and in mice. Today, IL-17 represents a family of structurally related cytokines that share a highly conserved C-terminal region but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family, IL-17A through IL-17F, are secreted as homodimers. IL-17F also regulates cartilage matrix turnover and inhibits angiogenesis.

Gene Name

IL17F

Gene ID

112744

UniProt

Q96PD4

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 500mM Acetic Acid. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : ED50 is approximately 10 ng/ml. Specific Activity of 1.0 x 10^5 IU/mg

Amino Acids

MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ

Beschrijving

Source: E.coli. MW :30.1kD. Recombinant Human Interleukin-17F is produced by our E.coli expression system and the target gene encoding Arg31-Gln163 is expressed

Specificaties

ProductnaamRecombinant Human Interleukin-17F/IL-17F
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-7024-10