
Recombinant Human Interleukin-20/IL-20
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Source: E.coli. MW :20.07kD. Recombinant Human Interleukin-20 is produced by our E.coli expression system and the target gene encoding Leu25-Glu176 is expressed. Interleukin-20 (IL-20) is a member of the IL-10 family of regulatory cytokines that includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. IL-20 exhibits approximately 28% amino acid identity with IL-10 and 76% amino acid identity with mouse IL-20. There are two heterodimeric receptor complexes for IL-20. The first is composed of IL-20 Ra and IL-20 R beta. The second is composed of IL-22 R and IL-20 R beta. Whereas the IL-22 R/IL-20 R beta complex is shared with IL-24, the IL-20 Ra/IL-20 R beta complex is shared with both IL-19 and IL-24. IL-20 has been shown to initiate transduction cascades involving STAT3 and stimulates the induction of pro-inflammatory genes including TNF-a and MCP-1. Initial functional studies using transgenic mice suggest that IL-20 has the ability to regulate skin development. The over-expression of both human and mouse forms of IL-20 results in keratinocyte hyper-proliferation, abnormal epidermal differentiation, and neonatal lethality. In humans, IL-20 and its receptors are up-regulated in psoriatic skin, and polymorphisms in the IL-20 gene have been associated with plaque-type psoriasis. IL-20 may also have a role in hematopoiesis. It enhances the proliferation of multi-potential progenitors in vitro and increases their numbers and cell cycling status in IL-20 transgenic mice. IL-20 is also shown to suppress COX-2 and PGE2 and acts as an inhibitor of angiogenesis in model systems.
IL20
50604
Q9NYY1
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
The product is shipped at ambient temperature.
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Beschrijving
Source: E.coli. MW :20.07kD. Recombinant Human Interleukin-20 is produced by our E.coli expression system and the target gene encoding Leu25-Glu176 is expressed
Specificaties
Recent bekeken producten

Simulated Dermal Fluid (BZ457) - 100 mL
BZ457-01
100 mL

Polyclonal BDNF Antibody
APG02253G
0.05mg

Biotin-Recombinant (sf9) Marburg virus glycoprotein (Musoke, HA-tag, >95%), purified
MVGP16-BTN
100 µL

MARV VP40/Marburg VP40 Protein (N-His, Lake Victoria marburgvirus (strain Musoke-80) (MARV) (Marburg virus (strain Kenya/Musoke/1980) ) )
P505862
100 µg

Hettich Centrifuge Rotanta 460R Refrigerated Large Volume
CEN0703
1 Each

X4RF Refrigerated Centrifuge
75009936
1 Each

Drug Stability Chamber
500-DSC102
1 Unit

Modular Incubator Chamber
MIC-101
1 Unit
Recent gezochte producten

Dried Body Fluids DNA Purification Kit
K1464-250
250 Preparations

Dried Body Fluids DNA Purification Kit
K1464-50
50 Preparations

Simulated Bile Juice (BZ263) - 100 mL
BZ263-01
100 mL

Simulated Blood Serum (BZ278) - 100 mL
BZ278-01
100 mL

Simulated Blood Matrix (BZ281) - 100 mL
BZ281-01
100 mL

Simulated Body Fluid Corrected (c-SBF) (BZ310) - 100 mL
BZ310-01
100 mL

Simulated Body Fluid (SBF) ISO 23317 Method - 1000mL
BZ361-01
100 mL

Simulated Bone Marrow Medium (BZ373) - 100 mL
BZ373-01
100 mL
