Recombinant Human LAG-3/CD233 (Leu23-Leu450)
Gecertificeerd

Recombinant Human LAG-3/CD233 (Leu23-Leu450)

Catalog #: 32-9009-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :47.2kD. Recombinant Human Lymphocyte Activation Gene 3 Protein is produced by our Mammalian expression system and the target gene encoding Leu23-Leu450 is expressed with a 6His tag at the C-terminus. Human Lymphocyte activation gene 3 protein (LAG3) is a member of immunoglobulin (Ig) superfamily. LAG3 contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. LAG3 is involved in lymphocyte activation and can bind to HLA class-II antigens. It is selectively expressed in activated T and NK cells. LAG3 has a negative regulatory function in T cells and acts as as a new marker of T cell induced B cell activation. As a soluble molecule, LAG3 activates antigen-presenting cells through MHC class II signaling. It can lead to increased antigen-specific T-cell responses in vivo. LAG-3 has higher affinity to MHC class II than CD4.

Gene Name

LAG3

Gene ID

3902

UniProt

P18627

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLVDHHHHHH

Beschrijving

Source: Human Cells. MW :47.2kD. Recombinant Human Lymphocyte Activation Gene 3 Protein is produced by our Mammalian expression system and the target gene encod

Specificaties

ProductnaamRecombinant Human LAG-3/CD233 (Leu23-Leu450)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-9009-50