Recombinant Human Mortality Factor 4-Like Protein 2/MORF4L2/MRGX (C-6His)

Source: E.coli. MW :33.37kD. Recombinant Human Mortality Factor 4-Like Protein 2 is produced by our E.coli expression system and the target gene encoding Met1-Leu288 is expressed with a 6His tag at the C-terminus. Mortality Factor 4-Like Protein 2 (MORF4L2) is a member of the mortality factor (MORF) family. MORF4L2 localizes in the nucleus, possessing a protein kinase C phosphorylation site and a tyrosine phosphorylation site. MORF4L2 interacts with the Rb tumor suppressor and it has histone deacetylase activity which can either repress or promote the activity of the B-Myb promoter depending on the tissue. In addition, MORF4L2 is involved in cell growth, regulation, and senescence.

MORF4L2

9643

Q15014

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKALLEHHHHHH