Recombinant Human Neuronal Acetylcholine Receptor Subunit beta-3/CHRNB3 (C-6His)
Gecertificeerd

Recombinant Human Neuronal Acetylcholine Receptor Subunit beta-3/CHRNB3 (C-6His)

Catalog #: 32-8413-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :25.3kD. Recombinant Human CHRNB3 is produced by our Mammalian expression system and the target gene encoding Ile25-Leu232 is expressed with a 6His tag at the C-terminus. Neuronal acetylcholine receptor subunit beta-3 (CHRNB3) is a cell membrane protein and belongs to the ligand-gated ion channel (TC 1.A.9) family. CHRNB3 seems to be composed of two different type of subunits: alpha and beta. The CHRNB3 are (hetero) pentamers composed of homologous subunits. The subunits that make up the muscle and neuronal forms of CHRNB3 are encoded by separate genes and have different primary structure. There are several subtypes of neuronal CHRNB3 that vary based on which homologous subunits are arranged around the central channel. They are classified as alpha-subunits if like muscle alpha-1, they have a pair of adjacent cysteines as part of the presumed acetylcholine binding site. Subunits lacking these cysteine residues are classified as beta-subunits.

Gene Name

CHRNB3

Gene ID

1142

UniProt

Q05901

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

IAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRLLDHHHHHH

Beschrijving

Source: Human Cells. MW :25.3kD. Recombinant Human CHRNB3 is produced by our Mammalian expression system and the target gene encoding Ile25-Leu232 is expressed

Specificaties

ProductnaamRecombinant Human Neuronal Acetylcholine Receptor Subunit beta-3/CHRNB3 (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8413-50