Recombinant Human Persephin
Gecertificeerd

Recombinant Human Persephin

Catalog #: 32-8375-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E. coli. MW :10.4kD. Recombinant Human Persephin is produced by our E.coli expression system and the target gene encoding Ala61-Gly156 is expressed. Persephin is a secreted protein, belongs to the glial cell linederived neurotrophic factor (GDNF) family of the TGF- beta superfamily. It shares 38-46% amino acid (aa) identity with family members GDNF, neurturin and artemin. It is expressed at very low levels in most tissues. Mature protein contains a signal sequence, a pro-domain and a 96 aa mature sequence with several cysteines that are conserved among family members. It circulates as an unglycosylated disulfide-linked homodimer. Like other GDNF family members, Persephin acts through engagement of GRFa4, a glycosylphosphatidylinositol (GPI) -linked GDNF receptor family Persephin is reported to promote both the survival and growth of central dopaminergic and motor neurons, and kidney development. These effects are correlated with the expression patterns of GFRa4, and RET.

Gene Name

PSPN

Gene ID

5623

UniProt

O60542

Components

Lyophilized from a 0.2 μm filtered solution of 4mM HCl.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GSALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG

Beschrijving

Source: E. coli. MW :10.4kD. Recombinant Human Persephin is produced by our E.coli expression system and the target gene encoding Ala61-Gly156 is expressed. Per

Specificaties

ProductnaamRecombinant Human Persephin
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8375-50