Recombinant Human Persephin

Source: E. coli. MW :10.4kD. Recombinant Human Persephin is produced by our E.coli expression system and the target gene encoding Ala61-Gly156 is expressed. Persephin is a secreted protein, belongs to the glial cell linederived neurotrophic factor (GDNF) family of the TGF- beta superfamily. It shares 38-46% amino acid (aa) identity with family members GDNF, neurturin and artemin. It is expressed at very low levels in most tissues. Mature protein contains a signal sequence, a pro-domain and a 96 aa mature sequence with several cysteines that are conserved among family members. It circulates as an unglycosylated disulfide-linked homodimer. Like other GDNF family members, Persephin acts through engagement of GRFa4, a glycosylphosphatidylinositol (GPI) -linked GDNF receptor family Persephin is reported to promote both the survival and growth of central dopaminergic and motor neurons, and kidney development. These effects are correlated with the expression patterns of GFRa4, and RET.

PSPN

5623

O60542

Lyophilized from a 0.2 μm filtered solution of 4mM HCl.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

GSALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG