Recombinant Human Prefoldin Subunit 2/PFDN2 (N-6His)
Gecertificeerd

Recombinant Human Prefoldin Subunit 2/PFDN2 (N-6His)

Catalog #: 32-7232-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E.coli. MW :18.8kD. Recombinant Human Prefoldin Subunit 2 is produced by our E.coli expression system and the target gene encoding Met1-Ser154 is expressed with a 6His tag at the N-terminus. Prefoldin Subunit 2 (PFDN2) belongs to the Prefoldin Beta subunit family. The PFDN2 protein is one of six subunits of Prefoldin that act as a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly. PFDN2 binds specifically to Cytosolic Chaperonin (c-CPN) and transfers target proteins to it. PFDN2 also binds to a nascent polypeptide chain and promotes folding in settings where there are many competing pathways for non-native proteins.

Gene Name

PFDN2

Gene ID

5202

UniProt

Q9UHV9

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 50mM NaCl, 1mM DTT, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS

Beschrijving

Source: E.coli. MW :18.8kD. Recombinant Human Prefoldin Subunit 2 is produced by our E.coli expression system and the target gene encoding Met1-Ser154 is expres

Specificaties

ProductnaamRecombinant Human Prefoldin Subunit 2/PFDN2 (N-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-7232-10