Recombinant Human S100A7

Source: E. coli. MW :11.5kD. Recombinant Human S100A7 is produced by our E.coli expression system and the target gene encoding Met1-Gln101 is expressed. S100A7 is a 11-12 kDa member of the S100 family of EF hand calcium binding proteins. Human S100A7 shares 32% amino acid sequence identity with mouse S100A7A, the closest related protein in mouse. It is acetylated at the N-terminus and binds both calcium and zinc ions. S100A7 is up-regulated in keratinocytes of psoriasis and atopic dermatitis lesions, as well as in epithelial cells of the tongue, eye, and female genital tract. Its up-regulation can be induced by bacterial exposure, inflammatory cytokines, or epidermal barrier disruption. S100A7 supports epithelial integrity through killing E. coli by sequestration of zinc and through inducing the up-regulation of tight junction proteins. The interaction of S100A7 with RAGE promotes the migration of immune cells and the infiltration of macrophages into tumor sites.

S100A7

6278

P31151

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

The product is shipped on dry ice/ice packs.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ