Recombinant Human Signal Transducer en Activator van Transcription 3/STAT3 (C-6His)

Source: E. coli. MW :21.8kD. Recombinant Human STAT3 is produced by our E.coli expression system and the target gene encoding Met1-Asn175 is expressed with a 6His tag at the C-terminus. Signal Transducer and Activator of Transcription 3 (STAT3) belongs to the transcription factor STAT family. STAT3 contains one SH2 domain and is a transcription factor expressed in most cell types. STAT3 is activated by multiple cytokines and growth factors including: IFN-a, IL-10, IL-6, IL-11, IL-12, IL-2, EGF etc. STAT3 functions as signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF and other growth factors. In addition, STAT3 may also mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4.

STAT3

6774

P40763

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNLEHHHHHH