Recombinant Human SLAM Family Member 5/SLAMF5/CD84 (C-6His)

Source: Human Cells. MW :23.1kD. Recombinant Human SLAM Family Member 5 is produced by our Mammalian expression system and the target gene encoding Lys22-Arg220 is expressed with a 6His tag at the C-terminus. SLAM family member 5 (SLAMF5/CD84) is a type I transmembrane protein in the SLAM subgroup of the CD2 family. SLAM family proteins regulate multiple aspects of immune system function. Mature human CD84 consists of a 204 amino acid (aa) extracellular domain (ECD) with two Iglike domains, a 21 aa transmembrane segment, and a 99 aa cytoplasmic domain with two immunoreceptor tyrosinebased switch motifs (ITSMs) . CD84 exhibits homophilic binding which is mediated by the N-terminal Ig-like domain. Ligation induces tyrosine phosphorylation in the cytoplasmic ITSMs which then recruit the signaling adaptor molecules SAP (SLAM-associated protein) and EAT-2 (EWS/Fli1-activated transcript 2) .CD84 signaling inhibits Fc epsilon RI-induced mast cell activation but enhances platelet activation. LPS-induced macrophage activation, T cell proliferation and IFN- gamma production, and the interactions between T cells and B cells that are required for germinal center formation.

CD84

8832

Q9UIB8

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRHHHHHH