Recombinant Human Small Ubiquitin-related Modifier 1/SUMO1 (N-6His)
Gecertificeerd

Recombinant Human Small Ubiquitin-related Modifier 1/SUMO1 (N-6His)

Catalog #: 32-7153-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E.coli. MW :13.7kD. Recombinant Human SUMO1 is produced by our E.coli expression system and the target gene encoding Met1-Val101 is expressed with a 6His tag at the N-terminus. Small Ubiquitin-Related Modifier 1 (SUMO1) is an Ubiquitin-like protein that belongs to the ubiquitin family with SUMO subfamily. It is a family of small, related proteins that can be enzymatically attached to a target protein by a post-translational modification process termed sumoylation. SUMO1 functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. SUMO1 is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. SUMO1 is not active until the last four amino acids of the carboxy-terminus are cleaved off. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins and may also regulate a network of genes involved in palate development.

Gene Name

SUMO1

Gene ID

7341

UniProt

P63165

Components

Lyophilized from a 0.2 μm filtered solution of 50mM TrisHCl, 100mM NaCl, 1mM DTT, pH 8.5 .

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNNTPKELGMEEEDVIEVYQEQTGGHSTV

Beschrijving

Source: E.coli. MW :13.7kD. Recombinant Human SUMO1 is produced by our E.coli expression system and the target gene encoding Met1-Val101 is expressed with a 6Hi

Specificaties

ProductnaamRecombinant Human Small Ubiquitin-related Modifier 1/SUMO1 (N-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-7153-10