Recombinant Human Small Ubiquitin-related Modifier 3/SUMO3/SMT3A

Source: E. coli. MW :11.6kD. Recombinant Human SUMO3 is produced by our E.coli expression system and the target gene encoding Met1-Phe103 is expressed. SUMO3 belongs to the SUMO protein family and operates like ubiquitin. Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polyer. Nevertheless unlike ubiquitin that targets proteins for degration, SUMO3 takes part in several cellular processess, such as nuclear transport, transcription regulation, apoptosis and protein stability. SUMO3 participates in amyloid beta generation and has a key role in the oneset or progression of Alzheimer's disease.

SUMO3

6612

P55854

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF