Recombinant Human U6 snRNA-geassocieerde Sm-Like Protein LSm1/LSM1 (C-6His)

Source: E.coli. MW :16.23kD. Recombinant Human LSM1 is produced by our E.coli expression system and the target gene encoding Met1-Tyr133 is expressed with a 6His tag at the C-terminus. U6 snRNA-Associated Sm-Like Protein LSm1 (LSM1) belongs to the snRNP Sm proteins family. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which plays an important role in pre-mRNA splicing. LSM1 binds specifically to the 3-terminal U-tract of U6snRNA. LSM1 can interact with SLBP when histone mRNA is being rapidly degraded during the S phase. In addition, LSM1 is associated with cellular transformation and the progression of several malignancies including mesothelioma, lung cancer and breast cancer.

LSM1

27257

O15116

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEYVEHHHHHH