Recombinant Humane amyloid beta A4 Precursor Proteïne-Binding A3/APBA3/X11-gamma (C-6His)
Gecertificeerd

Recombinant Humane amyloid beta A4 Precursor Proteïne-Binding A3/APBA3/X11-gamma (C-6His)

Catalog #: 32-8042-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E.coli. MW :15.48kD. Recombinant Human APBA3 is produced by our E.coli expression system and the target gene encoding Met1-Leu138 is expressed with a 6His tag at the C-terminus. Amyloid beta A4 Precursor Protein-Binding Family A Member 3 (APBA3) is an adapter protein that belongs to the X11 family. APBA3 contains 2 PDZ (DHR) domains and 1 PID domain and interacts with the Alzheimer's disease amyloid precursor protein.. APBA3 is believed to be involved in signal transduction processes. Unlike X11-a and - beta which are generally neuronal proteins, APBA3 is widely expressed in all tissues examined with lower levels in brain and testis. It binds to the cytoplasmic domain of amyloid protein (APP) in vivo and may modulate processing of the beta-amyloid precursor protein (APP) and hence formation of beta-APP.

Gene Name

APBA3

Gene ID

9546

UniProt

O96018

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB ,150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRMELDESSLQELVQQFEALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAHGLLSAEAGRDDLLGLLHCEECPPSQTGPEEPLEPAPRLLEHHHHHH

Beschrijving

Source: E.coli. MW :15.48kD. Recombinant Human APBA3 is produced by our E.coli expression system and the target gene encoding Met1-Leu138 is expressed with a 6H

Specificaties

ProductnaamRecombinant Humane amyloid beta A4 Precursor Proteïne-Binding A3/APBA3/X11-gamma (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8042-50