Recombinant humane CD3 e/CD3E (C-Fc)

Source: Human Cells. MW :38.7kD. Recombinant Human CD3 epsilon is produced by our Mammalian expression system and the target gene encoding Asp23-Asp126 is expressed with a Fc tag at the C-terminus. T-Cell Surface Glycoprotein CD3 e Chain (CD3e) is a single-pass type I membrane protein. CD3e contains 1 Ig-like (immunoglobulin-like) domain and 1 ITAM domain. CD3e is a polypeptide encoded by the CD3E gene on chromosome 11 in humans. The T cell receptor-CD3 complex (TCR/CD3 complex) is involved in T-cell development and several intracellular signal-transduction pathways. This complex is critical for T-cell development and function, and represents one of the most complex transmembrane receptors. The T cell receptor-CD3 complex is unique in having ten cytoplasmic immunoreceptor tyrosine-based activation motifs (ITAMs) . TCR/CD3 complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways.

CD3E

916

P07766

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

The product is shipped on dry ice/ice packs.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK