Recombinant humane CD55/DAF (C-6His)

Source: Human Cells. MW :36kD. Recombinant Human CD55 is produced by our Mammalian expression system and the target gene encoding Asp35-Ser353 is expressed with a 6His tag at the C-terminus. CD55 is a member of the RCA (regulators of complement activation) family. RCA proteins is characterized by the presence of four to 30 SCRs (short consensus repeats also called CCPs for control protein modules) in their plasmaexposed regions. CD55 containing four SCR modules is involved in the regulation of the complement cascade. CD55 is known to bind CD97 via the first SCR. It also binds physiologically generated C3 convertases with its second and third SCRs. Binding results in an accelerated “decay”, or dissociation of active C3 convertases, thus blocking the development of Câ€TM attack complexes on nonforeign cells. It is known that viruses and bacteria also utilize multiple SCR sites for infection.

CD55

1604

P08174

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSVDHHHHHH