Recombinant Humane insuline-achtige groeifactor I/IGF-I/IGF1 (4-70)

Source: E.coli. MW :7.3kD. Recombinant Human Insulin-like Growth Factor I is produced by our E.coli expression system and the target gene encoding Thr52-Ala118 is expressed. Insulin-like growth factor I (IGF1) belongs to the family of insulin-like growth factors that are structurally homologous to proinsulin. Mature IGFs are generated by proteolytic processing of inactive precursor protein containing N-terminal and C-terminal propeptide regions. Mature human IGF-I consisting of 70 amino acids with 94% identity with mouse IGF1 and exhibits cross-species activity. IGF1 binds IGF-1R, IGF-2R, and the insulin receptor and plays a key role in cell cycle progression, cell proliferation and tumor progression. IGF1 expression is regulated by growth hormone.

IGF1

3479

P05019

Lyophilized from a 0.2 μm filtered solution of 300mM NaAc, pH 6.5.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 500mM Acetic Acid. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.05 ng/μg (0.5 IEU/μg) as determined by LAL test.

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA