Recombinant humane predipocyte Factor-1/protein d Homolog 1/Pref-1/DLK-1 (C-6His)

Source: Human Cells. MW :30.15kD. Recombinant Human DLK-1 is produced by our Mammalian expression system and the target gene encoding Ala24-Pro297 is expressed with a 6His tag at the C-terminus. Protein Delta Homolog 1 (DLK-1) is a transmembrane protein which contains a signal peptide, an extracellular domain with six tandem epidermai growth factor (EGF) -like domains, a single pass transmembrane domain, and a short cytoplasmic tail. It is found within the stromal cells in close contact to the vascular structure of placental villi, yolk sac, fetal liver, adrenal cortex and pancreas and in the beta cells of the islets of Langerhans in the adult pancreas. In addition, it is detected in some forms of neuroendocrine lung tumor tissue. DLK-1 may have a improtant role in neuroendocrine differentiation.

DLK1

8788

P80370

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPNGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPVDHHHHHH