Recombinant Mouse Activin Receptor-achtige Kinase 1/ALK-1/ACVRL1 (C-Fc)

Source: Human Cells. MW :38.1kD. Recombinant Mouse Activin Receptor-like Kinase 1 is produced by our Mammalian expression system and the target gene encoding Asp23-Pro119 is expressed with a Fc tag at the C-terminus. Activin Receptor-Like Kinase 1 (ALK-1) is a type I cell-surface receptor for the TGF- beta superfamily of ligands, which mediates signaling of BMP9 (bone morphogenetic protein) and BMP10. ALK1 signaling is necessary for angiogenesis during embryogenesis, wound healing, and tumor growth. ALK-1 has a high degree of similarity in serine-threonine kinase subdomains, a glycine and serine rich region preceding the kinase-domain, and a C-terminal tail with other activin receptor-like kinase proteins. ALK-1 is mainly expressed in endothelial cells regulating proliferation and migration in vitro and angiogenesis in vivo. Mutations in ALK-1 as well as in endoglin are associated with hereditary hemorrhagic telangiectasia (HHT), suggesting ALK-1 plays a critical role for in the control of blood vessel development or repair.

Acvrl1

11482

Q61288

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

DLAKPSKLVNCTCESPHCKRPFCQGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHLPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK