Recombinant Mouse BMP Receptor IA/ALK-3/CD292 (C-Fc-6His)
Gecertificeerd

Recombinant Mouse BMP Receptor IA/ALK-3/CD292 (C-Fc-6His)

Catalog #: 32-8480-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :42.2kD. Recombinant Mouse BMP Receptor IA is produced by our Mammalian expression system and the target gene encoding Gln24-Arg152 is expressed with a Fc, 6His tag at the C-terminus. ALK-3 is a type I receptor for bone morphogenetic proteins (BMPs) which belong to the protein kinase superfamily, TKL Ser/Thr protein kinase family and TGFB receptor subfamily. The BMP receptors consists of the type I receptors BMPR1A and BMPR1B and the type I I receptor BMPR2. Seven known type I serine/threonine kinases and five mammalian type II serine/threonine kinase receptors function in TGF-beta superfamily signal transduction. The downstream molecules of the type I BMP receptors include the Smad (Smad1, 5 and 8) proteins that are phosphorylated in a ligand-dependent manner, and relay the BMP signal from the receptors to target genes in the nucleus. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. ALK-3 contains a GS domain and a protein kinase domain. ALK-3 is widely expressed. Defects in BMPR1A gene are a cause of a significant proportion of cases of Juvenile polyposis syndrome (JPS) .

Gene Name

Bmpr1a

Gene ID

12166

UniProt

P36895

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QNLDSMLHGTGMKSDLDQKKPENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH

Beschrijving

Source: Human Cells. MW :42.2kD. Recombinant Mouse BMP Receptor IA is produced by our Mammalian expression system and the target gene encoding Gln24-Arg152 is e

Specificaties

ProductnaamRecombinant Mouse BMP Receptor IA/ALK-3/CD292 (C-Fc-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8480-50