Recombinant Mouse C-X-C motief Chemokine 15/CXCL15/Lungkine (C-6His)

Source: Human Cells. MW :17.4kD. Recombinant Mouse C-X-C motif chemokine 15 is produced by our Mammalian expression system and the target gene encoding Gln26-Ala167 is expressed with a 6His tag at the C-terminus. Mouse C-X-C motif chemokine 15, also known as Cxcl15, is a secreted protein which is member of the ELR motif-containing CXC chemokines. It expressed at low levels in fetal lung, the expression restricted to the lung, produced by bronchoepithelial cells and is released into the airways. It plays an important role in lung-specific neutrophil trafficking during normal and inflammatory conditions. It also appears chemotactic for neutrophils.

Cxcl15

20309

Q9WVL7

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDAVDHHHHHH