Recombinant Mouse Cytotoxisch T-Lymfocyten Proteïne 4/CTLA-4/CD152 (C-6His)
Gecertificeerd

Recombinant Mouse Cytotoxisch T-Lymfocyten Proteïne 4/CTLA-4/CD152 (C-6His)

Catalog #: 32-8798-10
Maat: 10 µg
Droogijs Vereist

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human cells. MW :14.6kD. Recombinant Mouse Cytotoxic T-lymphocyte protein 4 is produced by our Mammalian expression system and the target gene encoding Ala37-Asp161 is expressed fused with a 6His tag at the C-terminus. Mouse Cytotoxic Tlymphocyte 4 (CTLA-4, CD152), is a type I transmembrane T cell inhibitory molecule. Within the ECD, Mouse CTLA-4 shares 68% aa sequence identity with human. CTLA4 is similar to the T cell costimulatory protein CD28 since both of the molecules bind to CD80 and CD86 on antigen-presenting cells. CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal. Intracellular CTLA4 is also found inregulatory T cells and may play an important role in their functions. T cell activation through the T cell receptor and CD28 leads to increased expression of CTLA4. Genetic variations of CTLA4 have been associated with susceptibility to systemic lupus erythematosus (SLE), Gravesdisease (GRD), Celiac disease type3 (CELIAC3) and Hepatitis B virus infection (HBVinfection) .

Gene Name

Ctla4

Gene ID

12477

UniProt

P09793

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDHHHHHH

Beschrijving

Source: Human cells. MW :14.6kD. Recombinant Mouse Cytotoxic T-lymphocyte protein 4 is produced by our Mammalian expression system and the target gene encoding

Specificaties

ProductnaamRecombinant Mouse Cytotoxisch T-Lymfocyten Proteïne 4/CTLA-4/CD152 (C-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-8798-10