Recombinant Mouse Fibrillin-1/Asprosine (N-8His)
Gecertificeerd

Recombinant Mouse Fibrillin-1/Asprosine (N-8His)

Catalog #: 32-7873-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :16.9kD. Recombinant Mouse Fibrillin-1 is produced by our Mammalian expression system and the target gene encoding Ser2732-His2871 is expressed with a 8His tag at the N-terminus. Asprosin is a protein hormone that is produced by white adipose tissue in mammals (and potentially by other tissues), which is then transported to the liver and stimulates it to release glucose into the blood stream. In the liver asprosin activates rapid glucose release by a cAMP-dependent pathway. The glucose release by the liver into the blood stream is vital for brain function and survival during fasting. People with neonatal progeroid syndrome lack asprosin, while people with insulin resistance have it in abundance. In animal tests asprosin showed potential for treating type 2 diabetes. When antibodies targeting asprosin were injected into diabetic mice, blood glucose and insulin levels improved.

Gene Name

Fbn1

Gene ID

14118

UniProt

Q61554

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HHHHHHHHSTNETDASDIQDGSEMEANVSLASWDVEKPASFAFNISHVSNKVRILELLPALTTLMNHNRYLIESGNEDGFFKINQKEGVSYLHFTKKNAVAGTYSLQISSTPLYKKKELNQLEDRYDKDYLSGELGDNLKMKIQILLH

Beschrijving

Source: Human Cells. MW :16.9kD. Recombinant Mouse Fibrillin-1 is produced by our Mammalian expression system and the target gene encoding Ser2732-His2871 is ex

Specificaties

ProductnaamRecombinant Mouse Fibrillin-1/Asprosine (N-8His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-7873-10