Recombinant Mouse Fibroblast growth Factor 2/FGF-2/FGFb (Met1-Ser154)
Gecertificeerd

Recombinant Mouse Fibroblast growth Factor 2/FGF-2/FGFb (Met1-Ser154)

Catalog #: 32-7037-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E.coli. MW :17.15kD. Recombinant Mouse Fibroblast growth factor 2 is produced by our E.coli expression system and the target gene encoding Met1-Ser154 is expressed. FGF basic is one of 22 mitogenic proteins of the FGF family, which show 35-60% amino acid conservation. Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. The 17 kDa mouse sequence has 98% aa identity with rat, and 95% identity with human, bovine, and sheep FGF basic. Binding of FGF to heparin or cell surface HSPG is necessary for binding, dimerization and activation of tyrosine kinase FGF receptors. FGF basic binds other proteins, polysaccharides and lipids with lower affinity. Expression of FGF basic is nearly ubiquitous but disruption of the mouse FGF basic gene gives a relatively mild phenotype, suggesting compensation by other FGF family members. FGF basic modulates such normal processes as angiogenesis, wound healing and tissue repair, embryonic development and differentiation, neuronal function and neural degeneration. Transgenic overexpression of FGF basic results in excessive proliferation and angiogenesis is reminiscent of a variety of pathological conditions.

Gene Name

Fgf2

Gene ID

14173

UniProt

P15655

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 400mM NaCl, pH 7.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Beschrijving

Source: E.coli. MW :17.15kD. Recombinant Mouse Fibroblast growth factor 2 is produced by our E.coli expression system and the target gene encoding Met1-Ser154 i

Specificaties

ProductnaamRecombinant Mouse Fibroblast growth Factor 2/FGF-2/FGFb (Met1-Ser154)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-7037-10