Recombinant Mouse IL-1 Receptor type 1/IL-1R-1 (C-Fc)

Source: Human Cells. MW :64kD. Recombinant Mouse Interleukin-1 receptor type 1 is produced by our Mammalian expression system and the target gene encoding Leu20-Lys338 is expressed with a Fc tag at the C-terminus. Mouse Interleukin-1 receptor type 1/IL-1 RI is a cytokine receptor that belongs to the interleukin-1 receptor family. This protein is a receptor for interleukin 1 alpha (IL1A), interleukin 1 beta (IL1B), and interleukin 1 receptor antagonist (IL1RA) . It is an important mediator involved in many cytokine induced immune and inflammatory responses. An IL1 receptor accessory protein that can heterodimerize with the Type I receptor in the presence of IL1a or IL1 betabut not IL1ra, was identified. This Type I receptor complex appears to mediate all the known IL1 biological responses. The receptor Type II has a short cytoplasmic domain and does not transduce IL1 signals. In addition to the membranebound form of IL1 RII, a naturallyoccurring soluble form of IL1 RII has been described. It has been suggested that the Type II receptor, either as the membranebound or as the soluble form, serves as a decoy for IL1 and inhibits IL1 action by blocking the binding of IL1 to the signaling Type I receptor complex.

Il1r1

16177

P13504

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

The product is shipped on dry ice/ice packs.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWNDPFLAEDYQFVEHPSTKRKYTLITTLNISEVKSQFYRYPFICVVKNTNIFESAHVQLIYPVPDFKIEGRDMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK