
Recombinant Mouse Interferon gamma/IFN-gamma
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Source: Human Cells. MW :15.5kD. Recombinant Mouse Interferon gamma is produced by our Mammalian expression system and the target gene encoding His23-Cys155 is expressed. Mouse Ifng is a secreted protein which belongs to the type I I (or gamma) interferon family. IFNG is produced by lymphocytes and activated by specific antigens or mitogens. In addition to having antiviral activity, IFNG also has important immunoregulatory functions. It is a potent activator of macrophages and has antiproliferative effects on transformed cells. It can potentiate the antiviral and antitumor effects of the type I interferons. Genetic variation in IFNG is associated with the risk of aplastic anemia (AA) which is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis.
Ifng
15978
P01580
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
The product is shipped on dry ice/ice packs.
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
Beschrijving
Source: Human Cells. MW :15.5kD. Recombinant Mouse Interferon gamma is produced by our Mammalian expression system and the target gene encoding His23-Cys155 is
Specificaties
Recent bekeken producten

Biotin-Recombinant (sf9) Marburg virus glycoprotein (Musoke, HA-tag, >95%), purified
MVGP16-BTN
100 µL

MARV VP40/Marburg VP40 Protein (N-His, Lake Victoria marburgvirus (strain Musoke-80) (MARV) (Marburg virus (strain Kenya/Musoke/1980) ) )
P505862
100 µg

Hettich Centrifuge Rotanta 460R Refrigerated Large Volume
CEN0703
1 Each

X4RF Refrigerated Centrifuge
75009936
1 Each

Drug Stability Chamber
500-DSC102
1 Unit

Modular Incubator Chamber
MIC-101
1 Unit

CYP707A2 Antibody
GTR17947107
2 mg

SsDNA Assay Kit
12645ES60
100 Tests
