Recombinant Mouse Interleukin-2 Receptor Subunit Gamma/IL-2 R gamma/CIDX (C-Fc)
Gecertificeerd

Recombinant Mouse Interleukin-2 Receptor Subunit Gamma/IL-2 R gamma/CIDX (C-Fc)

Catalog #: 32-9012-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :55.1kD. Recombinant Mouse Interleukin-2 Receptor Subunit Gamma is produced by our Mammalian expression system and the target gene encoding Ser25-Ala263 is expressed with a Fc tag at the C-terminus. The Interleukin-2 receptor gamma chain (IL-2 R gamma , CD132) of the high affinity functional mouse IL-2 receptor complex is a member the hematopoietin receptor family. It is expressed on most lymphocyte (white blood cell) populations, and its gene is found on the X-chromosome of mammals. Common IL2 receptor- gamma Chain is required for IL-2 receptor signaling. Besides IL-2, the Common IL2 receptor- gamma chain has been shown to be a component of the functional receptor complexes for IL-4, IL-7, IL-9 and IL-15. It is a component of multiple cytokine receptors that are essential for lymphocyte development and function. Common IL2 receptor- gamma Chain is also designated the common gamma chain.

Gene Name

Il2rg

Gene ID

16186

UniProt

Q3UPA9

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Beschrijving

Source: Human Cells. MW :55.1kD. Recombinant Mouse Interleukin-2 Receptor Subunit Gamma is produced by our Mammalian expression system and the target gene encod

Specificaties

ProductnaamRecombinant Mouse Interleukin-2 Receptor Subunit Gamma/IL-2 R gamma/CIDX (C-Fc)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-9012-50