Recombinant Mouse Low Affinity IgG Fc Receptor IV/FcgR4/CD16-2 (C-6His)
Gecertificeerd

Recombinant Mouse Low Affinity IgG Fc Receptor IV/FcgR4/CD16-2 (C-6His)

Catalog #: 32-8906-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :21.9kD. Recombinant Mouse Low Affinity Immunoglobulin Gamma Fc Region Receptor IV is produced by our Mammalian expression system and the target gene encoding Gly21-Gln203 is expressed with a 6His tag at the C-terminus. Fcgr4, also known as CD16-2, is one of the receptors for Fc region of IgG which involve in immune responses. Fcgr4 mainly functions in cellular response to lipopolysaccharide, NK T cell proliferation, regulation of sensory perception of pain, wound healing etc. Three groups are included for Fc gamma receptors (FcR), and they are Fc gamma RI (CD64), Fc gamma RII (CD32), and Fc gamma RIII (CD16) . Among these, CD64 possess high affinity even for monomeric IgG, while CD32 and CD16 display a relative lower affinity for IgG. Genes encodes these receptors are diverse differing by species and cell types. The aggregation of FcR having immunoreceptor tyrosine-based activation motifs (ITAMs) activates sequentially src family tyrosine kinases and syk family tyrosine kinases that connect transduced signals to common activation pathways shared with other receptors. FcR with ITAMs elicit cell activation, endocytosis, and phagocytosis. Fcgr4 belongs to Fc gamma RIII (CD16) group.

Gene Name

Fcgr4

Gene ID

246256

UniProt

Q8R2R4

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYSQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQVDHHHHHH

Beschrijving

Source: Human Cells. MW :21.9kD. Recombinant Mouse Low Affinity Immunoglobulin Gamma Fc Region Receptor IV is produced by our Mammalian expression system and th

Specificaties

ProductnaamRecombinant Mouse Low Affinity IgG Fc Receptor IV/FcgR4/CD16-2 (C-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-8906-10