Recombinant Mouse Phospholipase A2 Groep IB/PLA2G1B (C-6His)
Gecertificeerd

Recombinant Mouse Phospholipase A2 Groep IB/PLA2G1B (C-6His)

Catalog #: 32-8995-50
Maat: 50 µg
Droogijs Vereist

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :15.6kD. Recombinant Mouse Phospholipase A2 is produced by our Mammalian expression system and the target gene encoding Ala16-Cys146 is expressed with a 6His tag at the C-terminus. Mouse phospholipase A2 is a secreted protein which belongs to the phospholipase A2 family. Phospholipase A2/PLA2G1B catalyzes the release of fatty acids from glycero-3-phosphocholines. The best known varieties are the digestive enzymes secreted as zymogens by the pancreas of mammals. PLA2G1B has been thought to play major role in digestion of glycerophospholipids in nutrients, given its abundance in digestive organs. Since its expression has been observed in non-digestive organs including the lung, spleen, kidney, ovary, retina, brain, and neurons, its function may not limited to digestive role. PLA2G1B are resistant to obesity and diabetes induced by feeding a diabetogenic high-fat/high-carbohydrate diet. PLA2G1B inhibition may be a potentially effective oral therapeutic option for treatment of obesity and diabetes.

Gene Name

Pla2g1b

Gene ID

18778

UniProt

Q9Z0Y2

Components

Supplied as a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl, pH 7.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AHSISPRAVWQFRNMIKCTIPGSDPLKDYNNYGCYCGLGGWGTPVDDLDRCCQTHDHCYSQAKKLESCKFLIDNPYTNTYSYSCSGSEITCSAKNNKCEDFICNCDREAAICFSKVPYNKEYKNLDTGKFCHHHHHH

Beschrijving

Source: Human Cells. MW :15.6kD. Recombinant Mouse Phospholipase A2 is produced by our Mammalian expression system and the target gene encoding Ala16-Cys146 is

Specificaties

ProductnaamRecombinant Mouse Phospholipase A2 Groep IB/PLA2G1B (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8995-50