
Recombinant Mouse SLAM Familielid 8/SLAMF8 (C-6His)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Source: Human Cells. MW :24.2kD. Recombinant Mouse SLAM Family Member 8 is produced by our Mammalian expression system and the target gene encoding Val21-Asp231 is expressed with a 6His tag at the C-terminus. Mouse SLAM family member 8/SLAMF8 is a single-pass type I membrane protein. It contains one Ig-likeC2-type domain. SLAMF8 is expressed in lymphnode, spleen, thymus and bone marrow. The signaling lymphocyte activation molecule (SLAM) family includes homophilic and heterophilic receptors that modulate both adaptive and innate immune responses. These receptors share a common ectodomain organization: a membrane-proximal immunoglobulin constant domain and a membrane-distal immunoglobulin variable domain that is responsible for ligand recognition. SLAM family of receptors is expressed by a wide range of immune cells. Through their cytoplasmic domain, SLAM family receptors associate with SLAM-associated protein (SAP) -related molecules, a group of cytoplasmic adaptors composed almost exclusively of an SRC homology 2 domain. SLAM family receptors, inassociation with SAP family adaptors, have crucial roles during normal immune reactions in innate and adaptive immune cells. It may play a role in B-lineage commitment and/or modulation of signaling through the B-cell receptor.
Slamf8
74748
Q9D3G2
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
The product is shipped at ambient temperature.
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
VQVLSKVGDSELLVAECPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRVQLYDNLSLELGPLKPGDSGNFSVLMVDTGGQTWTQTLYLKVYDAVPKPEVQVFTAAAEETQPLNTCQVFLSCWAPNISDITYSWRWEGTVDFNGEVRSHFSNGQVLSVSLGLGDKDVAFTCIASNPVSWDMTTVTPWESCHHEAASGKASYKDHHHHHH
Beschrijving
Source: Human Cells. MW :24.2kD. Recombinant Mouse SLAM Family Member 8 is produced by our Mammalian expression system and the target gene encoding Val21-Asp231
Specificaties
Recent bekeken producten

3-D Life Dextran-PEG Hydrogel SG
G92-1
1 Each

Plant Preservative Mixture (PPM)
P5550-01
25 mL

PhaseShield™ Gel Tubes, Heavy (50x 2ml)
M2302-05H
50x 2 mL

Parvovirus B19
OT020
1 Each

Anti- Protein A Antibody
GWB-E66F30
1 mL

Recombinant TAFV GP1 Protein, C-Fc
EVV03609
100 μg

Gabbr1 Mouse Monoclonal Antibody [Clone ID: S93A-49]
TA326530
100 µg

BSA-Myc/DDK Control Protein
AR100025
50 µL
