Recombinant Mouse SLAM Familielid 8/SLAMF8 (C-6His)
Gecertificeerd

Recombinant Mouse SLAM Familielid 8/SLAMF8 (C-6His)

Catalog #: 32-8950-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :24.2kD. Recombinant Mouse SLAM Family Member 8 is produced by our Mammalian expression system and the target gene encoding Val21-Asp231 is expressed with a 6His tag at the C-terminus. Mouse SLAM family member 8/SLAMF8 is a single-pass type I membrane protein. It contains one Ig-likeC2-type domain. SLAMF8 is expressed in lymphnode, spleen, thymus and bone marrow. The signaling lymphocyte activation molecule (SLAM) family includes homophilic and heterophilic receptors that modulate both adaptive and innate immune responses. These receptors share a common ectodomain organization: a membrane-proximal immunoglobulin constant domain and a membrane-distal immunoglobulin variable domain that is responsible for ligand recognition. SLAM family of receptors is expressed by a wide range of immune cells. Through their cytoplasmic domain, SLAM family receptors associate with SLAM-associated protein (SAP) -related molecules, a group of cytoplasmic adaptors composed almost exclusively of an SRC homology 2 domain. SLAM family receptors, inassociation with SAP family adaptors, have crucial roles during normal immune reactions in innate and adaptive immune cells. It may play a role in B-lineage commitment and/or modulation of signaling through the B-cell receptor.

Gene Name

Slamf8

Gene ID

74748

UniProt

Q9D3G2

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VQVLSKVGDSELLVAECPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRVQLYDNLSLELGPLKPGDSGNFSVLMVDTGGQTWTQTLYLKVYDAVPKPEVQVFTAAAEETQPLNTCQVFLSCWAPNISDITYSWRWEGTVDFNGEVRSHFSNGQVLSVSLGLGDKDVAFTCIASNPVSWDMTTVTPWESCHHEAASGKASYKDHHHHHH

Beschrijving

Source: Human Cells. MW :24.2kD. Recombinant Mouse SLAM Family Member 8 is produced by our Mammalian expression system and the target gene encoding Val21-Asp231

Specificaties

ProductnaamRecombinant Mouse SLAM Familielid 8/SLAMF8 (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8950-50